PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000206212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 281aa    MW: 31632.8 Da    PI: 6.5219
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000206212genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.49.1e-4341411127
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                    lppGfrF+Pt+eel+++yL+kk++g++      ++++i+ v iy+++Pw+Lp+     ++++ ++w+fF++r++++a+g r++r t++gyWkatg+
  MDP0000206212   4 LPPGFRFSPTEEELISFYLQKKLDGRSedlnRVVDRIIPVVYIYEFNPWELPQaageXIHGDPEQWFFFIPRQESEARGGRPRRLTTTGYWKATGS 99 
                    79************************966533334479999**********9646665666778******************************** PP

            NAM  89 dkevlsk...kgelvglkktLvfykgrapkgektdWvmheyr 127
                      +v+s+   + +++glk+t+vfy+grap+g kt+W m+ey+
  MDP0000206212 100 PSTVYSSnsnHXRAIGLKRTMVFYTGRAPHGXKTEWKMNEYK 141
                    ******96555566***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-443182IPR003441NAC domain
PROSITE profilePS5100547.8464182IPR003441NAC domain
PfamPF023652.0E-225141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEDLPPGFRF SPTEEELISF YLQKKLDGRS EDLNRVVDRI IPVVYIYEFN PWELPQAAGE  60
XIHGDPEQWF FFIPRQESEA RGGRPRRLTT TGYWKATGSP STVYSSNSNH XRAIGLKRTM  120
VFYTGRAPHG XKTEWKMNEY KAIEIHADDN NQXSMAASSS NPSTPSTPTL RQEFSLCRVY  180
KKSKCLRAFD RRPPGIEITR NPNLNIQAAP AQTADHLDQG LTTSNRNPQN MEGRTNSSSP  240
ESSSSGGHGS QSSQPEQSGT LPMAVDNEAI WDLDQXINFL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-34418217165NO APICAL MERISTEM PROTEIN
1ut4_B2e-34418217165NO APICAL MERISTEM PROTEIN
1ut7_A2e-34418217165NO APICAL MERISTEM PROTEIN
1ut7_B2e-34418217165NO APICAL MERISTEM PROTEIN
3swm_A2e-34418220168NAC domain-containing protein 19
3swm_B2e-34418220168NAC domain-containing protein 19
3swm_C2e-34418220168NAC domain-containing protein 19
3swm_D2e-34418220168NAC domain-containing protein 19
3swp_A2e-34418220168NAC domain-containing protein 19
3swp_B2e-34418220168NAC domain-containing protein 19
3swp_C2e-34418220168NAC domain-containing protein 19
3swp_D2e-34418220168NAC domain-containing protein 19
4dul_A2e-34418217165NAC domain-containing protein 19
4dul_B2e-34418217165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387035.10.0PREDICTED: NAC domain-containing protein 90-like
TrEMBLM5VSR51e-136M5VSR5_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s22580.12e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-59NAC domain containing protein 90